DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Phae1

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:250 Identity:67/250 - (26%)
Similarity:112/250 - (44%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAH 67
            :||:|:.   ::.|.:: ...:|::.||....|....:.|:::.||...|...|::.|.::||||
  Fly    16 LLLLGIC---RISGVAI-GAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAH 76

  Fly    68 CLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAG 132
            ||... .||...|:.|....:.........||..|..::..|.... :..|:.:|.....|..:.
  Fly    77 CLTNS-NQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGT-VPYDIGMIYTPTAFVWSA 139

  Fly   133 NASLVKIDYNDLPPHSNLTVLGWGAINEQG-HNWNQCLQEA-NVKLISHRECIKSVGSGWQKVTN 195
            ..:.|.:..:.:.|.....:.|||:.:... .::...||.| ||.:||...|..::|:....|.:
  Fly   140 AVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHS 204

  Fly   196 NMFCALG--KNARDACQGDSGGPAIYAGRSVGIVSWG-YGCG-SGYPGVYTRLSS 246
            ...|. |  ......|..|||||.:.....:|||||| ..|| :..|.||.::||
  Fly   205 TNLCT-GPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 60/225 (27%)
Tryp_SPc 27..246 CDD:238113 60/224 (27%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 61/226 (27%)
Tryp_SPc 36..266 CDD:238113 61/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.