DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG4271

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:256 Identity:64/256 - (25%)
Similarity:107/256 - (41%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHA 83
            ||......|:.|........:||.::...|...|||.:|....|||||.|::.:  .|:.:||..
  Fly    11 LFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNK--PVKRITVRV 73

  Fly    84 QQQCLGDDMPPEHVRSAWYVGLS-----PNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKI---- 139
            .        .|:..|....:.::     .||   :..|:|:|::.|.:|   ..:..:.||    
  Fly    74 G--------TPDIYRGGRIIRVTALVVHENY---KNWDNDIALLWLEKP---VLSVRVTKIPLAT 124

  Fly   140 ---DYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCAL 201
               ..|:.|.::     |||....:.:...:.||....|:.....|.:.:   .:.|...:.||.
  Fly   125 KEPSENEYPSNA-----GWGEKLLESYVVTRKLQNGVTKIRPRSMCAEEL---VEPVGEELLCAF 181

  Fly   202 GKNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITY--WLKDFIER 259
             ....|.|.||.|||.:.|.:.|||...|:||| :..|.:||.:    ..|  |:::..|:
  Fly   182 -YTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNV----FHYLEWIEENAEK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 59/232 (25%)
Tryp_SPc 27..246 CDD:238113 59/231 (26%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 61/243 (25%)
Tryp_SPc 19..231 CDD:214473 60/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.