DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG11911

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:284 Identity:70/284 - (24%)
Similarity:116/284 - (40%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLHQLEGSSLF--------TLRQGKIFGGKTTLVKDHS--FLVNLRRG---GKFRCGGVIISP 59
            :||:...:|:.|.        :...|.:..|  |..:.||  ::|:|...   ....|||.:|:.
  Fly    10 IALVAAAQGAKLSDKLAKLVPSFATGFVING--TEAEPHSAPYIVSLATNYLKHSHICGGTLINK 72

  Fly    60 NCVLTAAHCLE---------GRY--QQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQR 113
            :.::|||||:.         |.:  .:|.:||...|.     |....|.:....||         
  Fly    73 DWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQV-----DFGRVHEKYTGGVG--------- 123

  Fly   114 GLDSDLAVIRLSRPFDIA---GNASLVKIDYND------LPP----HSNLTVL-GWGAINEQGHN 164
                         |:|||   .|.|.:   :|:      ||.    |...|.| |||.......:
  Fly   124 -------------PYDIALLHVNESFI---FNEWVQPATLPSREQVHEGETHLYGWGQPKSYIFS 172

  Fly   165 WNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIY-----AGRSV 224
            ..:.||....:::::.||.:.:........:|:..:..:.::.||.||||||.:.     ....:
  Fly   173 GAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELI 237

  Fly   225 GIVSWGY-GCG-SGYPGVYTRLSS 246
            ||||||| .|| :..|.:||::|:
  Fly   238 GIVSWGYIPCGLANMPSIYTKVSA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 64/256 (25%)
Tryp_SPc 27..246 CDD:238113 64/255 (25%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 65/257 (25%)
Tryp_SPc 37..266 CDD:214473 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.