DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Prss53

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:229 Identity:59/229 - (25%)
Similarity:86/229 - (37%) Gaps:57/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPN 108
            |:..||..|||.::|...|||||||..||             |.|.:          |.|||...
Mouse   318 LKHHGKLACGGALVSEVVVLTAAHCFIGR-------------QTLEE----------WSVGLGAG 359

  Fly   109 --------------YCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYND--LPPHSNLTVLGW-- 155
                          |....| ..|:|.:.|::|..:......:.:.|.|  ||...:    ||  
Mouse   360 PEEWGLKQLILHGAYTHPEG-GYDVAFLLLAQPVTLGPGLRPLCLPYADHHLPDGEH----GWVL 419

  Fly   156 GAINEQGHNWNQCLQEANVKLISHRECIK---SVGSGWQKVTNNMFCALGKNARDACQGDSGGPA 217
            |...:.|.|:.|.:.   |.::....|.:   :.|.....:...|.|.........|:|.||.|.
Mouse   420 GLTQKAGINYPQTVP---VTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPHCEGLSGAPL 481

  Fly   218 IYAGRS----VGIVSWGYGC-GSGYPGVYTRLSS 246
            ::..|.    ||:.|:|..| .|..|.|:..||:
Mouse   482 VHEIRGTWFLVGLHSFGDTCQSSAKPAVFAALSA 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 58/227 (26%)
Tryp_SPc 27..246 CDD:238113 58/227 (26%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 59/229 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.