DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and sphe

DIOPT Version :10

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:97 Identity:22/97 - (22%)
Similarity:31/97 - (31%) Gaps:29/97 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DDHAAERNTMSMNYELAATLSDEEQRAR---KGKAKIVCKEEDHVFIKKKEKYEEESEKREFFSH 67
            ||.....|:...||.|.     :||...   .....|:|.....:::..|      ||..:|.|.
  Fly    81 DDFKCTVNSCYYNYYLT-----QEQIVHFVIGAMTVILCARLFIMYLTAK------SEVTKFLSQ 134

  Fly    68 VPRK------------IRPALRY---PQPNFE 84
            ..|.            |.|:..|   |..:||
  Fly   135 ATRVALLDSLTIFTFFILPSFAYAQFPATDFE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 27..246 CDD:238113 16/76 (21%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 22/97 (23%)

Return to query results.
Submit another query.