DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG33160

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:239 Identity:74/239 - (30%)
Similarity:123/239 - (51%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVH--AQQQ 86
            |.:|.||..:.:|:..:||.:....:. |||.::.|..|:|||||:..:.:  .|..::  |..|
  Fly    31 QPRIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNK--NDFKIYGGASNQ 92

  Fly    87 CLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLT 151
            .    .|...:|:..|:.:.|:: .::.|:.|:|.:||:... |..|...:.:....:|..:.:.
  Fly    93 A----GPYAVIRTVDYIAIRPDF-NRKTLNMDVAALRLNSDM-IGANIETIPLAAQSVPARALVK 151

  Fly   152 VLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGP 216
            |.|||.:........:.:....|.:.|...|: |...|..::|.:|.||.....:|:|.||||||
  Fly   152 VSGWGFLTADATKTAERVHSVLVPMWSRASCV-SAFRGIHRITRSMVCAARLYKKDSCDGDSGGP 215

  Fly   217 AIYAGRSVGIVSWGYGCGSGYPGVYTRLSSPSITYWLKDFIERH 260
            .:|.|:..||||:||||.|..||:||  |.|.|..|.:..:|:|
  Fly   216 LVYRGQLAGIVSFGYGCASALPGIYT--SVPEIRDWFQRVVEQH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 67/221 (30%)
Tryp_SPc 27..246 CDD:238113 67/220 (30%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/227 (31%)
Tryp_SPc 34..253 CDD:238113 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.