DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and gd

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:214 Identity:48/214 - (22%)
Similarity:79/214 - (36%) Gaps:60/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FRCGGVIISPNCVLTAAHCLE---GRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWY--------- 102
            |:|||.::|...|:::|||.:   .||.....|..      ||     .|....|.         
  Fly   278 FQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVF------LG-----RHNLKNWNEEGSLAAPV 331

  Fly   103 --VGLSPNYCAQ-RGLDSDLAVIRLS---------RPFDIAGNASLVKIDYNDLPPHSNLTVLGW 155
              :.:.|::.:| ...|:|:|||.|.         ||..:...:|  |.:|  :.....: |:||
  Fly   332 DGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSS--KTEY--IVGERGI-VIGW 391

  Fly   156 GAINEQGHNWNQCLQE---------------ANVKLISHRECIKSVGSGWQKVTNNMFCA-LGKN 204
             :.:......:|.|..               ....::.:.||.::........:|..||| :...
  Fly   392 -SFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAE 455

  Fly   205 ARDACQGDSGGPAIYAGRS 223
            .||..|   .|.:||.|.|
  Fly   456 ERDTHQ---SGASIYTGIS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 48/214 (22%)
Tryp_SPc 27..246 CDD:238113 48/214 (22%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 48/214 (22%)
Tryp_SPc 258..526 CDD:214473 48/214 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.