DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG33159

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:266 Identity:95/266 - (35%)
Similarity:139/266 - (52%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIGLALL----H---QLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCV 62
            ::||.||    |   .|..||..|    :|.|||.|.:.:..:||.||:.|.|.|||.:||...|
  Fly     1 MVGLRLLWWLCHLALVLPSSSSKT----RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAV 61

  Fly    63 LTAAHCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRP 127
            |:||||:.|  .|....||||....|..:.|.  ||:......||:|.| ...|.|:|:::|...
  Fly    62 LSAAHCVYG--SQPEGFTVHAGASRLDQEAPV--VRNVVMFHTSPSYSA-TNFDMDVALLQLQEV 121

  Fly   128 FDIA-GNASLVKIDYNDLPPHSN--LTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSG 189
            ..:. |..:.:....|  ||..|  ..:.|||...|......:.::...|:::...|| |...||
  Fly   122 VVLTPGKVATISPCRN--PPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAEC-KISYSG 183

  Fly   190 WQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWL 253
            :.:::::|.||..:..||:|.||||||.:|.|:..||||||:||. ..:|||||.::|..:    
  Fly   184 YGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVASERV---- 244

  Fly   254 KDFIER 259
            .:|||:
  Fly   245 HEFIEQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 82/223 (37%)
Tryp_SPc 27..246 CDD:238113 82/222 (37%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 82/223 (37%)
Tryp_SPc 26..251 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.