DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG32376

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:112/258 - (43%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQ 75
            ::.||....|..|   |..||.....:..|..:|...|.|.||.|||:...:|||.||..|..::
  Fly    53 INALEAQESFPTR---IVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEK 114

  Fly    76 VRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKID 140
            . .:.|.:.||..|..:  .||:....:....:|..:.    |||:::|..|.........||: 
  Fly   115 Y-TVRVGSDQQRRGGQL--RHVKKIVALAAYNDYTMRH----DLAMMKLKSPVYFGKCVRPVKL- 171

  Fly   141 YNDLPPHSNLT-------VLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMF 198
                 |.:..|       |.|||..:....|..:.|:...:..|...:|.|.......|:..:|.
  Fly   172 -----PSTKTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMI 231

  Fly   199 CALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLKDFIERH 260
            ||...| :|:|.||||||....|...||||||.||.: .|||||  ::......|:|..|.::
  Fly   232 CASRTN-KDSCSGDSGGPLTSRGVLYGIVSWGIGCANKNYPGVY--VNCKRYVPWIKKVIHKY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 70/227 (31%)
Tryp_SPc 27..246 CDD:238113 70/226 (31%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 71/237 (30%)
Tryp_SPc 66..287 CDD:238113 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.