DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG6041

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:287 Identity:85/287 - (29%)
Similarity:122/287 - (42%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILLIGLALLHQLEGSSLFTLRQG----KIFGGKTTLVKDHSFLVNLR--------RGGKFRCGGV 55
            ||.|.|.|.....|.||.:...|    ||.||....::..|:.|::|        .|....||||
  Fly     7 ILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71

  Fly    56 IISPNCVLTAAHC----------LEGRYQQV-----------RDLTVHAQQQCLGDDMPPEHVRS 99
            :||...|.|||||          ..|.:..|           |.|..:.||....::..|:    
  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPD---- 132

  Fly   100 AWYVGLSPNYCAQRGLDSDLAVIRLSR--PFD------IAGNASLVKIDYNDLPPHSNLTVLGWG 156
                          .|.:|:|::.::.  |::      :|.|:.||       ..:::..:.|||
  Fly   133 --------------ALTNDIALMFINGYIPWNWPTVTALALNSQLV-------ATNTDCLISGWG 176

  Fly   157 AINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALG--KNARDACQGDSGGPAIY 219
            .:.:.|...:..||.|.|.::|:..|..|..|    :..:..|| |  ....||||||||||...
  Fly   177 LLQQNGTFSSNTLQAATVPIVSYTTCRISYNS----IPVSQVCA-GYLSGGVDACQGDSGGPMSC 236

  Fly   220 AGRSVGIVSWGYGCGS-GYPGVYTRLS 245
            .|...||||:|.||.: |||||||.:|
  Fly   237 NGMLAGIVSYGAGCAAPGYPGVYTNVS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 76/260 (29%)
Tryp_SPc 27..246 CDD:238113 75/259 (29%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 76/260 (29%)
Tryp_SPc 35..272 CDD:238113 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.