DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG3795

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:303 Identity:85/303 - (28%)
Similarity:130/303 - (42%) Gaps:69/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYILLIGLALLHQLEGS-----SLFTLRQGK-------IFGG----KTTLVKDHSFLVNLRRG-- 47
            :|||||.::.....|..     |..:.||.:       :.||    ...|||   :.|:||.|  
  Fly     8 VYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVK---YTVSLRMGKP 69

  Fly    48 GKF-----RCGGVIISPNCVLTAAHCL--EGRYQQVRDLTVHA-----------QQQCLGDDMPP 94
            .||     .|.|.|.|...:||||||:  ..|..:.:.|.|.|           .|....:::.|
  Fly    70 KKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLP 134

  Fly    95 EHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKID-YNDLP-PHSNLTVLGWGA 157
            .           |.|...:....|:.:|.|..  |::...::.||. ||.:| ..:..:::|||.
  Fly   135 H-----------PKYKKGKSQKYDIGLILLEA--DLSLGDAVAKIPLYNKVPVAGAPCSIVGWGT 186

  Fly   158 INEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNAR--DACQGDSGGPAIYA 220
            :.:.|...::.: ..:::::....|.|.:  ||...  .|.||..|:..  |:||||||||.|..
  Fly   187 VIQFGPLPDEAI-NGDMQILPDTFCEKLL--GWSNA--GMLCANDKHDSDVDSCQGDSGGPLICD 246

  Fly   221 GRSVGIVSWGYGCGS-GYPGVYTRLSSPSITYWLKDFI-ERHC 261
            ....||||:|.|||. ...|:||.:      |..:|:| |..|
  Fly   247 NMVTGIVSFGMGCGEPDSAGIYTDV------YHFRDWITENSC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 71/255 (28%)
Tryp_SPc 27..246 CDD:238113 71/247 (29%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/244 (28%)
Tryp_SPc 60..278 CDD:214473 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.