DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and LOC286960

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:238 Identity:77/238 - (32%)
Similarity:113/238 - (47%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVR--DLTVH---AQQ 85
            ||.||.|.......:.|:|..|...:|||.:||...||:||||.: |..|||  :..:|   ..:
  Rat    23 KIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYK-RKLQVRLGEHNIHVLEGGE 86

  Fly    86 QCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNL 150
            |.:..:....|          |.| .:..||:|:.:|:|..|..:....|.|.:..:.....:..
  Rat    87 QFIDAEKIIRH----------PEY-NKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQC 140

  Fly   151 TVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALG--KNARDACQGDS 213
            .|.|||.....|..:...||.....::|...|.||...   ::|:|||| ||  :..:|:|.|||
  Rat   141 LVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPG---QITSNMFC-LGFLEGGKDSCDGDS 201

  Fly   214 GGPAIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKD 255
            |||.:..|...||||||..|. .|.|||||::.  :...|:::
  Rat   202 GGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVC--NYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 76/227 (33%)
Tryp_SPc 27..246 CDD:238113 75/226 (33%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 76/234 (32%)
Tryp_SPc 24..243 CDD:238113 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.