DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and Prss3b

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:260 Identity:86/260 - (33%)
Similarity:128/260 - (49%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTA 65
            :::..:|.|:...|:..      ..||.||.|.......:.|:|..|..| |||.:|:...|::|
  Rat     5 IFLAFLGAAVALPLDDD------DDKIVGGYTCQKNSLPYQVSLNAGYHF-CGGSLINSQWVVSA 62

  Fly    66 AHCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDI 130
            |||.:.|. ||| |..|......|.    |....|..:...|:|.|.. .|:|:.:|:|:.|..:
  Rat    63 AHCYKSRI-QVR-LGEHNIDVVEGG----EQFIDAAKIIRHPSYNANT-FDNDIMLIKLNSPATL 120

  Fly   131 AGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTN 195
            ....|.|.:..:.....:...|.|||.....|.|:...||..:..::|...| ||...|  |:|:
  Rat   121 NSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSC-KSSYPG--KITS 182

  Fly   196 NMFCALG--KNARDACQGDSGGPAIYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKDFI 257
            |||| ||  :..:|:||||||||.:..|:..|:|||||||. .|.|||||::.  :...|::..:
  Rat   183 NMFC-LGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVC--NYVNWIQQTV 244

  Fly   258  257
              Rat   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 82/222 (37%)
Tryp_SPc 27..246 CDD:238113 81/221 (37%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 82/229 (36%)
Tryp_SPc 25..243 CDD:238113 82/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.