DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG30375

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:237 Identity:61/237 - (25%)
Similarity:102/237 - (43%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CGGVIISPNCVLTAAHC------------LEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWY-- 102
            |||.|:|...::|||||            |.|.:    ||:..|           |.:.:|.|  
  Fly   180 CGGSIVSERYIMTAAHCTARQPVASRLLALVGEH----DLSTGA-----------ESIYAAQYRI 229

  Fly   103 --VGLSPNYC-AQRGLDSDLAVIRLSRPFDIAGNASLVKI-------DYNDLPPHSNLTVLGWGA 157
              :...|.|. ...|..:|:|:::.:.|.:.:...:.:.:       .:|    :.|:.::|||.
  Fly   230 QNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQAENSFN----YQNVDIMGWGT 290

  Fly   158 INEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCA--LGKNARDACQGDSGGPAIYA 220
            :.......| .||:|.:..:.:..|.....|   .:|.:..|.  .|...:|:||.|||||.|..
  Fly   291 LGFAASKSN-TLQKATLLTMDNAVCRSRFNS---SITPSHLCTYDAGGRGQDSCQYDSGGPVILR 351

  Fly   221 GR----SVGIVSWGYGCGSGYP-GVYTRLSSPSITYWLKDFI 257
            .|    .:|::|:|..||..:. ||.||::|.  ..||..:|
  Fly   352 QRERMFQLGVISYGRACGQPFGIGVNTRVTSH--LNWLWRYI 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 57/224 (25%)
Tryp_SPc 27..246 CDD:238113 57/224 (25%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 58/230 (25%)
Tryp_SPc 152..387 CDD:238113 58/231 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.