DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32277 and CG30002

DIOPT Version :9

Sequence 1:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:282 Identity:70/282 - (24%)
Similarity:107/282 - (37%) Gaps:97/282 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IFGGKTTLVKDHSFLVNLRRGGKF---RCGGVIISPNCVLTAAHCLE--GRYQQVR------DL- 79
            |.||:.:.:....::..|......   ||||.:||...|||||||.:  .|.:::|      || 
  Fly    62 ITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGELDLS 126

  Fly    80 ------TVHAQQQCLGDDMPP--EHVRSAWYVG-----LSPNYCAQRGLDSDLAVIRLSRPFDIA 131
                  |.:.::.|    .||  |.....|.:.     ..|.|        |:|:|:|::     
  Fly   127 STSDCTTYNYERVC----APPVEEFTIDKWILHEEFNLFYPGY--------DIALIKLNK----- 174

  Fly   132 GNASLVKIDYND------LPPHSNL-----------TVLGWGAINEQGHNWNQCLQEANVKLISH 179
                  |:.:.|      ||....|           ..:|||.        .:.|:.||..:   
  Fly   175 ------KVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGK--------TESLRYANSTM--- 222

  Fly   180 RECIKSVGSGWQKVTN----NMFCALGKNARDACQGDSGGPAIY------AGRSV--GIVSWG-Y 231
                 .|....:|.|:    :..||.|... |.|.||||||.::      ..|:|  |:||.| .
  Fly   223 -----EVDIRTEKCTDGRDTSFLCASGDYV-DTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQ 281

  Fly   232 GCGSGYPGVYTRLSSPSITYWL 253
            .||:|:...|  :..|:...|:
  Fly   282 NCGAGHKAYY--MDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 68/273 (25%)
Tryp_SPc 27..246 CDD:238113 68/273 (25%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 69/280 (25%)
Tryp_SPc 62..301 CDD:238113 69/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.