DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:240 Identity:86/240 - (35%)
Similarity:126/240 - (52%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AASNEANS--RIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK-----GIGAS 73
            |.:..|||  :||||......||||.|:|..|.:..|||||::.|.|::||||.|     .:|..
Mouse    13 AVALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHCYKRRLQVRLGEH 77

  Fly    74 RILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGPKVSTIELCNTSFKA 137
            .|.|:.|..:..:      .:|:.....||..|:.:|:.::|||:| |...:|||:.|..:....
Mouse    78 NIDVLEGGEQFID------AEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLPRSCAST 136

  Fly   138 GDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEG 201
            .....|||||............::.::..::...:|...|.  |.||:.|||.. :.|.||:|:|
Mouse   137 NAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP--GQITSNMFCLGFLEGGKDSCDG 199

  Fly   202 DSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            |||||.|..|::.||||||..||.:..|||||.|....|:|.:.:
Mouse   200 DSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/224 (36%)
Tryp_SPc 25..244 CDD:238113 82/225 (36%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 81/224 (36%)
Tryp_SPc 24..243 CDD:238113 82/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.