DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and TPSAB1

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:259 Identity:81/259 - (31%)
Similarity:125/259 - (48%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ASNEANSR--IVGGVPVDIASVPYLVNLRIGGNF---MCGGSLVTPQHVVTAAHC----VKGIGA 72
            |..:|..|  ||||.....:..|:.|:||:.|.:   .|||||:.||.|:|||||    ||.:.|
Human    21 APGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAA 85

  Fly    73 SRILV----------VAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVS 126
            .|:.:          :..|:|:           :..|:.| |..:.:|:|:|:|:.|:: ...|.
Human    86 LRVQLREQHLYYQDQLLPVSRI-----------IVHPQFY-TAQIGADIALLELEEPVNVSSHVH 138

  Fly   127 TIEL--CNTSFKAGDLIKVSGWGQI-TERNKAVSMQVRSVDVALIPRKACMSQYKLRGTIT---- 184
            |:.|  .:.:|..|....|:|||.: .:........::.|.|.::....|.::|.| |..|    
Human   139 TVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHL-GAYTGDDV 202

  Fly   185 ----NTMFCASVPGVKDACEGDSGGPAVYQGQLC---------GIVSWGVGCARKSSPGVYTNV 235
                :.|.||.... :|:|:||||||.|     |         |:||||.|||:.:.||:||.|
Human   203 RIVRDDMLCAGNTR-RDSCQGDSGGPLV-----CKVNGTWLQAGVVSWGEGCAQPNRPGIYTRV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/252 (31%)
Tryp_SPc 25..244 CDD:238113 78/249 (31%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 78/249 (31%)
Tryp_SPc 31..267 CDD:214473 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.