DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss55

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:279 Identity:79/279 - (28%)
Similarity:131/279 - (46%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLW-LVLHLIPLC-------WAASNEAN-----------SRIVGGVPVDIASVPYLVNLRIGG 46
            :|||. ||.|.|..|       ..||:|..           |||:.|...::...|:.|:::...
Mouse    18 LATLCRLVGHHIRDCILTECLLCIASSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSIQESD 82

  Fly    47 NFMCGGSLVTPQHVVTAAHC--VKGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTS 109
            :..||||:::...::|.|||  .:.:..:.:.|..|...||.:.|...|..:...|.:....:.:
Mouse    83 HHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLTTSPVELEVTTIIRHKGFKRLNMDN 147

  Fly   110 DVAVLKLKAPISGPKVSTIELCNTSFKAGDL---IKVSGWGQITERNK-AVSMQVRSVDVALIPR 170
            |:|:|.|..|::..:: |:.:|...:.|...   ..|:|||.....:| ::|..:..|.:.:|..
Mouse   148 DIALLLLAKPLTFNEL-TVPICLPLWPAPPSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEW 211

  Fly   171 KACMSQYKLRGTITNTMFCASVPGVK-DACEGDSGGPAV---------YQGQLCGIVSWGVGCAR 225
            :.|:..:.   ::|..|.|||..... |||:||||||.|         ||   .||:|||..|.:
Mouse   212 EECLQMFP---SLTTNMLCASYGNESYDACQGDSGGPLVCTTDPGSRWYQ---VGIISWGKSCGK 270

  Fly   226 KSSPGVYTNVKTVRSFIDK 244
            |..||:||.:.....:|:|
Mouse   271 KGFPGIYTVLAKYTLWIEK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 65/233 (28%)
Tryp_SPc 25..244 CDD:238113 65/234 (28%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.