DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss41

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:128/266 - (48%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV-KGIG 71
            :.|:.:.....|:..||||||:.......|:..:||:..:..|||||::.:.|:|||||. |.:.
Mouse    67 IKLLSMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLD 131

  Fly    72 ASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDV-------------AVLKLKAPISGP 123
            ..:..|..|  :||..      ...:..|||:.|....|:             |:|:|.:.::..
Mouse   132 PEKWTVQLG--QLTSK------PSYWNRKAYSGRYRVKDIIVNSEDKLKSHDLALLRLASSVTYN 188

  Fly   124 K-VSTIELCNTSFKAGDLIK--VSGWGQITERNKAV--SMQVRSVDVALIPRKACMSQYK---LR 180
            | :..:.:..::|.:....:  |:|||.:.|..|.:  ...:|.|.|:::....|...::   |.
Mouse   189 KDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLH 253

  Fly   181 GTITNTMFCASV-PGVKDACEGDSGGPAV-------YQGQLCGIVSWGVGCARKSSPGVYTNVKT 237
            ..||..:|||.. .|..|.|.||||||.|       ||   .||||||:||.|.:.||:||||..
Mouse   254 HLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQ---IGIVSWGIGCGRPNLPGIYTNVSH 315

  Fly   238 VRSFID 243
            ..::|:
Mouse   316 YYNWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 77/247 (31%)
Tryp_SPc 25..244 CDD:238113 77/249 (31%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.