DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss32

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:252 Identity:80/252 - (31%)
Similarity:116/252 - (46%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV-KGIGASRILVVAG-VTRL 84
            :.|||.|....:...|:.|::|..|..:|||||:....|:|||||. :|...|...|:.| ::..
Mouse    51 SGRIVSGQDAQLGRWPWQVSVRENGAHVCGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSY 115

  Fly    85 TETG----VRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELC----NTSFKAGDLI 141
            .|..    :|:....:..|........:.|:|:::|.:|||.... .:.:|    ......|.:.
Mouse   116 PEDNEPKELRAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDY-MLPVCLPKPGDPLDPGTMC 179

  Fly   142 KVSGWGQI-TERNKAVSMQVRSVDVALIPRKACMSQYK---LRGT---ITNTMFCASV-PGVKDA 198
            .|:|||.| |.:.......::.:.|.||..:.|.:.|:   :.||   |...|.||.. .|.|||
Mouse   180 WVTGWGHIGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDA 244

  Fly   199 CEGDSGGPAVYQGQLC---------GIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            |.||||||.|     |         |:||||..||....|||||||....|:|...:
Mouse   245 CNGDSGGPLV-----CDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNTM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/244 (32%)
Tryp_SPc 25..244 CDD:238113 79/245 (32%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 79/244 (32%)
Tryp_SPc 54..295 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.