DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Klk12

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:237 Identity:78/237 - (32%)
Similarity:115/237 - (48%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIPLCWAASNEAN-SRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGAS 73
            |:.||....::|: .:|..||.....|.|:.|.|..|....|||.||..:.|:|||||     ..
Mouse     6 LLLLCAVGLSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHC-----RD 65

  Fly    74 RILVVAGVTRLTETG----VRSGVDKVYTPK---AYNTRTLTSDVAVLKLKAPISGPK-VSTIEL 130
            :.:|..|...||:..    :|.....:..|.   ||...  ..|:.:|:|..||...: |..:.|
Mouse    66 KYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNH--EHDLRLLRLNRPIHLTRAVRPVAL 128

  Fly   131 CNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGV 195
            .::....|.:..|||||...:.......:::.::::.:..:.|.:.:.  |.:|..|.||.....
Mouse   129 PSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFP--GRVTENMLCAGGEAG 191

  Fly   196 KDACEGDSGGPAVYQGQLCGIVSWG-VG-CARKSSPGVYTNV 235
            ||||:||||||.|..|.|.|:|||| || |.:|..|||||.|
Mouse   192 KDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 74/222 (33%)
Tryp_SPc 25..244 CDD:238113 74/221 (33%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 74/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.