DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG17242

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:221 Identity:62/221 - (28%)
Similarity:104/221 - (47%) Gaps:11/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTETGVRSGVDK 95
            :.|...|:..:::|.....|||.:.:...::|.|.||:......|.|..|..:....|....|:|
  Fly    22 IGIEQAPWQASVQINDKHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEK 86

  Fly    96 VYTPKAYNTRTLTSDVAVLKLKAPI---SGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVS 157
            :.. :....|  .||||:|:|::|:   .|  :..|.|.......|....||||||::..|.:..
  Fly    87 MRL-QVLGLR--PSDVAILQLRSPLYLDGG--IRAIPLATIPLVPGTNASVSGWGQLSAMNPSSE 146

  Fly   158 MQVRSVDVALIPRKACMSQYKLRGTITNT-MFCASVPG-VKDACEGDSGGPAVYQGQLCGIVSWG 220
            :.:| |||.:..:..|.:...|:|.:.:. ..||:..| :..||:|..|||.|...:|.||:||.
  Fly   147 VLLR-VDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQ 210

  Fly   221 VGCARKSSPGVYTNVKTVRSFIDKAL 246
            ..|...:...||.|:...:.:|:..:
  Fly   211 SACDVLNKSSVYANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 61/215 (28%)
Tryp_SPc 25..244 CDD:238113 62/217 (29%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 62/216 (29%)
Tryp_SPc 24..232 CDD:214473 61/213 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.