DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Klk4

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:238 Identity:70/238 - (29%)
Similarity:115/238 - (48%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK-----G 69
            ::.:..|:::..:|||:.|......|.|:...|.....|.|.|.||.||.|::||||::     |
Mouse    17 ILEVTGASASSVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVG 81

  Fly    70 IGASRILVVAGV----TRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKL-KAPISGPKVSTIE 129
            :|...:   .|.    :|:.|..:     .:..|. :|..:..:|:.::|| ::.|....:.:|.
Mouse    82 LGLHNL---KGSQEPGSRMLEAHL-----SIQHPN-FNDPSFANDLMLIKLNESVIESNTIRSIP 137

  Fly   130 LCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCA-SVP 193
            :.......||...||||||:  :|..:...::.|::::...:.|...|.  .....:|||| ...
Mouse   138 VATQCPTPGDTCLVSGWGQL--KNGKLPSLLQCVNLSVASEETCRLLYD--PVYHLSMFCAGGGQ 198

  Fly   194 GVKDACEGDSGGPAVYQGQLCGIVSWGVG-CARKSSPGVYTNV 235
            ..||:|.||||||.|....|.|:||.|.| |.:...|.||||:
Mouse   199 DQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 68/224 (30%)
Tryp_SPc 25..244 CDD:238113 67/223 (30%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.