DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and KLK6

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:267 Identity:84/267 - (31%)
Similarity:120/267 - (44%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAH 65
            |..|.:||.||...||   |..:::|.|.|.|..|.||...|...|:.:|||.|:.|..|:||||
Human     1 MKKLMVVLSLIAAAWA---EEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAH 62

  Fly    66 CVKGIGASRILVVAGVTRLTE---TGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVST 127
            |.|    ..:.|..|...|.:   :..:|.|.:......|:..:...|:.:|:|..|.       
Human    63 CKK----PNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPA------- 116

  Fly   128 IELCNTSFKAGDLIK----------------VSGWGQITERNKAVSMQVRSVDVALIPRKACMSQ 176
                    |..:||:                :.|||:..:.:...::|...:.  |:.|:.|...
Human   117 --------KLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIH--LVSREECEHA 171

  Fly   177 YKLRGTITNTMFCASVPGV-KDACEGDSGGPAVYQGQLCGIVSWG-VGCARKSSPGVYTNVKTVR 239
            |.  |.||..|.||..... ||:|:||||||.|....|.|:|||| :.|..|..|||||||....
Human   172 YP--GQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYT 234

  Fly   240 SFIDKAL 246
            ::|.|.:
Human   235 NWIQKTI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 73/238 (31%)
Tryp_SPc 25..244 CDD:238113 74/239 (31%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5520
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.