DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:198 Identity:66/198 - (33%)
Similarity:96/198 - (48%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RILVVAGVTRLTETGVRSGVDKVYTP------KAYNTRTLTSDVAVLKLKAPISGPK---VSTIE 129
            :::||||...|   |...|.::...|      ..||..|..:|:.::||.|||...:   ::.:.
Zfish     3 QMMVVAGDYTL---GANEGTEQYSKPLMLIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLP 64

  Fly   130 LCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCA-SVP 193
            ..||...||.:.:|||||..:.....:.:.:|:|.:.::....|.|.....|.||..|.|| |..
Zfish    65 KQNTGLLAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSST 129

  Fly   194 GVKDA---------------CEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFID 243
            |.|||               |:||||||.|..|::.|:||||.||.....|||||.|...|.:||
Zfish   130 GGKDACKNSTQYLCHLIVYLCQGDSGGPLVCDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWID 194

  Fly   244 KAL 246
            :.:
Zfish   195 QTI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 64/192 (33%)
Tryp_SPc 25..244 CDD:238113 65/194 (34%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 66/195 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.