DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and PRSS3

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:221 Identity:87/221 - (39%)
Similarity:122/221 - (55%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK-----GIGASRILVVAGV 81
            :.:||||...:..|:||.|:|..|.:| |||||::.|.||:||||.|     .:|...|.|:.|.
Human   107 DDKIVGGYTCEENSLPYQVSLNSGSHF-CGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGN 170

  Fly    82 TRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGPKVSTIELCNTSFKAGDLIKVSG 145
            .:.....      |:.....||..||.:|:.::||.:| :...:||||.|..|...||....:||
Human   171 EQFINAA------KIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISG 229

  Fly   146 WGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAVY 209
            ||...........:::.:|..::.:..|.:.|.  |.|||:|||.. :.|.||:|:.|||||.|.
Human   230 WGNTLSFGADYPDELKCLDAPVLTQAECKASYP--GKITNSMFCVGFLEGGKDSCQRDSGGPVVC 292

  Fly   210 QGQLCGIVSWGVGCARKSSPGVYTNV 235
            .|||.|:||||.|||.|:.|||||.|
Human   293 NGQLQGVVSWGHGCAWKNRPGVYTKV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 87/219 (40%)
Tryp_SPc 25..244 CDD:238113 87/218 (40%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 87/219 (40%)
Tryp_SPc 110..328 CDD:238113 87/218 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.