DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and PRSS1

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:237 Identity:87/237 - (36%)
Similarity:126/237 - (53%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG- 69
            |:|..:....||..:.:.:||||...:..||||.|:|..|.:| |||||:..|.||:|.||.|. 
Human   230 LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHF-CGGSLINEQWVVSAGHCYKSR 293

  Fly    70 ----IGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKA-PISGPKVSTIE 129
                :|...|.|:.|..:.....      |:.....|:.:||.:|:.::||.: .:...:||||.
Human   294 IQVRLGEHNIEVLEGNEQFINAA------KIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTIS 352

  Fly   130 LCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VP 193
            |.......|....:||||...........:::.:|..::.:..|.:.|.  |.||:.|||.. :.
Human   353 LPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYP--GKITSNMFCVGFLE 415

  Fly   194 GVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
            |.||:|:||||||.|..|||.|:||||.|||:|:.|||||.|
Human   416 GGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 83/219 (38%)
Tryp_SPc 25..244 CDD:238113 83/218 (38%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 83/219 (38%)
Tryp_SPc 249..467 CDD:238113 83/218 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.