DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and KLK15

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:254 Identity:85/254 - (33%)
Similarity:123/254 - (48%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK 68
            :||:|.|..|..:.:.:...:::.|......|.|:.|.|...|.|.||.||::|..|::||||  
Human     1 MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHC-- 63

  Fly    69 GIGASRILVVAGVTRLTETGV--RSGVDKVYT-------PKAYNTRTLTSDVAVLKLKAPIS-GP 123
               .||.:.|    ||.|..:  |.|.:::.|       |: |..|:..:|:.:|:|..|.. .|
Human    64 ---QSRFMRV----RLGEHNLRKRDGPEQLRTTSRVIPHPR-YEARSHRNDIMLLRLVQPARLNP 120

  Fly   124 KVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRS----------VDVALIPRKACMSQYK 178
            :|....|.......|:...|||||.::......:...||          .::::|...:|...|.
Human   121 QVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYP 185

  Fly   179 LRGTITNTMFCASVPG-VKDACEGDSGGPAVYQGQLCGIVSWG-VGCARKSSPGVYTNV 235
              |.:||||.||...| ..::||||||||.|..|.|.|||||| |.|...:.|||||.|
Human   186 --GRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 80/234 (34%)
Tryp_SPc 25..244 CDD:238113 80/233 (34%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.