DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss53

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:278 Identity:76/278 - (27%)
Similarity:118/278 - (42%) Gaps:81/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRI---LVVAGVTRLTETGVRSGVDKV-- 96
            |:..::|..|..:|.||||....|:|||||.:.:..:.:   .||.|  .|.:.|:..|.::|  
  Rat    49 PWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLG--SLKQEGLSPGAEEVGV 111

  Fly    97 ---YTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELC----NTSFKAGDLIKVSGWGQITE--- 151
               ..|||||..:..||:|:|:|..||    |.| .||    ...|..|.....:||.|.|.   
  Rat   112 AALQLPKAYNHYSQGSDLALLQLTHPI----VHT-TLCLPQPTHHFPFGASCWATGWDQNTSDGK 171

  Fly   152 ---RNKA------------------------------VSMQVRSVDVALIPRKAC------MSQY 177
               |:|:                              ||..:|::.:.||.|..|      :.|.
  Rat   172 YCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQR 236

  Fly   178 KLRGTITNTMFCASV-PGVKDACEGDSGGPAVYQGQLC----------GIVSWGVGCARKSSPGV 231
            .|.....:.|.|... |||:..|:||||||.     :|          ||:|:...||::.:|.:
  Rat   237 LLANPARSGMLCGGAQPGVQGPCQGDSGGPV-----MCREPDGHWVQVGIISFTSNCAQEDTPVL 296

  Fly   232 YTNVKT----VRSFIDKA 245
            .|::..    :::.:|:|
  Rat   297 LTDMAAHSSWLQAHVDRA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 74/273 (27%)
Tryp_SPc 25..244 CDD:238113 74/275 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 74/272 (27%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.