DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss36

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:247 Identity:88/247 - (35%)
Similarity:124/247 - (50%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIG----ASRILVVAG 80
            |.:||||||......:.|:.|:|..||..:|||||:.|..|::||||....|    |....|:.|
  Rat    54 EPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLG 118

  Fly    81 VTRLTETGVRSG-----VDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTS--FKA 137
            |.  ::.|...|     |..:..|..|:...|.:|:|:|:|.:|.. ||.|..:.|...|  |..
  Rat   119 VH--SQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFAH 181

  Fly   138 GDLIKVSGWGQITERNK-AVSMQVRSVDVALIPRKACMSQYKLRGTITNT------MFCASVP-G 194
            |.....:|||.:.|.:. .|...::.|::.|:...||...|...|....|      |.||..| |
  Rat   182 GTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEG 246

  Fly   195 VKDACEGDSGGPAVYQ--GQ--LCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242
            .:|.|:||||||.|.:  |:  |.||.|:|.||.|::.|||:|.|....|:|
  Rat   247 RRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 85/241 (35%)
Tryp_SPc 25..244 CDD:238113 85/242 (35%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 85/242 (35%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.