DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and prss3

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001004941.1 Gene:prss3 / 448342 XenbaseID:XB-GENE-6372192 Length:249 Species:Xenopus tropicalis


Alignment Length:252 Identity:88/252 - (34%)
Similarity:127/252 - (50%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAH 65
            |...|.::.|...  ||....:||||||......|.|:.|:|...|:|.|||||:.|:.:|:|||
 Frog     1 MIPFWAMMFLAVA--AAGPLDDSRIVGGYECAPHSKPWQVHLNYKGSFFCGGSLIAPRWIVSAAH 63

  Fly    66 C-------VKGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-G 122
            |       |..||...:....|..::.:      |:|.:....||:..:.:|:.::||..|.. .
 Frog    64 CYLLPKYVVAHIGMHDVSKAEGTVQIIQ------VEKSFQHYKYNSSNIDNDIMLIKLAEPAQFN 122

  Fly   123 PKVSTIELCNTSFKAGDLIKVSGW--------GQITERNKAVSMQVRSVDVALIPRKACMSQYKL 179
            ..|..|.|.::....|....|||:        |:..:|       ::.:|:.::|..:|.|.|  
 Frog   123 HHVQPIPLAHSCPMKGTRCVVSGYGNMRPGFFGEFPDR-------LQCLDLPVLPEDSCKSSY-- 178

  Fly   180 RGTITNTMFCASV-PGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
            ...|||.||||.. .|.||:|:||||||.|..|:|.|:||||..||:|..|||||.|
 Frog   179 GDDITNNMFCAGFQEGGKDSCQGDSGGPLVCDGELFGVVSWGHECAKKGYPGVYTKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 82/229 (36%)
Tryp_SPc 25..244 CDD:238113 81/228 (36%)
prss3NP_001004941.1 Tryp_SPc 23..245 CDD:238113 81/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.