DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:230 Identity:73/230 - (31%)
Similarity:111/230 - (48%) Gaps:24/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EANSRIVGGVPVDIASVPYLVNLRI--GGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVT 82
            :...||..|.|.....|||:|.|..  .||:.||||::....|:|||||..  |||.:.:..|.:
  Fly    31 DIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTN--GASGVTINYGAS 93

  Fly    83 RLTET----GVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIEL--CNTSFK--AGD 139
            ..|:.    .|.||  .:.....||:..|.:|:::::.........|:.:||  .|..::  ||.
  Fly    94 IRTQPQYTHWVGSG--DIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGW 156

  Fly   140 LIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVKDACEGDSG 204
            ....||||. |.....:...::||||.:|.:..|...:.|.    :.|.|.:..|.|..|.||||
  Fly   157 WAVASGWGG-TYDGSPLPDWLQSVDVQIISQSDCSRTWSLH----DNMICINTDGGKSTCGGDSG 216

  Fly   205 GPAV-YQG-QLCGIVSWG--VGCARKSSPGVYTNV 235
            ||.| :.| :|.|:.|:|  .|| :..:|.|::.|
  Fly   217 GPLVTHDGNRLVGVTSFGSAAGC-QSGAPAVFSRV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 73/226 (32%)
Tryp_SPc 25..244 CDD:238113 72/225 (32%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.