DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and intr

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:272 Identity:57/272 - (20%)
Similarity:105/272 - (38%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASNEANSRIVGG----------VPVDIASV---------------PYLVNLRIG 45
            ::.:::|..:..|.:.::|...|          :|.:|.::               .:::.:...
  Fly    44 VIEYIVPYPYQRSPKISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYE 108

  Fly    46 GNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTS- 109
            ...:|.|:|::.:.|:|:|.|..             ..|.:...||...:....:.|:...|.: 
  Fly   109 NKVICSGALISTRLVLTSALCFP-------------RTLRQPPPRSYKLQASRSRIYSVANLITG 160

  Fly   110 ---DVAVLKLKAPISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSM-----QVRSVDVA 166
               |:|:|.|.||:..|.|..|:||.:..:               ||..|:|     .:|.:...
  Fly   161 AIEDMALLLLHAPLEDPFVHPIDLCESPLR---------------RNDNVTMYMSQQHLRFLRTK 210

  Fly   167 LIPRKACMSQYKL--RGTITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSP 229
            |||...|...|..  ...||.||.||........|:...|...::|.:|||:..:|..|:.....
  Fly   211 LIPNSNCKRSYAQDENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVN 275

  Fly   230 G-VYTNVKTVRS 240
            | :|.:|...|:
  Fly   276 GELYADVFKART 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 55/254 (22%)
Tryp_SPc 25..244 CDD:238113 54/253 (21%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.