DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG5255

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:125/262 - (47%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASNEAN----------SRIVGGVPVDIASVPYLVNLR-IG-GNFMCGGSLVTPQ 58
            ::|.|:||....|:.|:          :|||||........||.::|: || |...|||:::..:
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDER 65

  Fly    59 HVVTAAHCVKGIGASRILVVAGVTRLTETGVRSGVDKVYTP------KAYNTRTLTSDVAVLKLK 117
            .::|||||.:|..|:...|:.|...|.:.|     .|.|.|      ..|..|...:|:|:|.|.
  Fly    66 WIITAAHCTRGRQATAFRVLTGTQDLHQNG-----SKYYYPDRIVEHSNYAPRKYRNDIALLHLN 125

  Fly   118 APISGPKVS-TIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRG 181
            ..|.....: .:||.:.:...|..:.::|||.:: ....|..:::|::|..:|.:.|.:.:....
  Fly   126 ESIVFDNATQPVELDHEALVPGSRLLLTGWGTLS-LGGDVPARLQSLEVNYVPFEQCRAAHDNST 189

  Fly   182 TITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            .:.....|......:.||.||||||.|:.|:|..:|:||:.|| |..|..:.::.....||...|
  Fly   190 RVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFIRTHL 253

  Fly   247 GM 248
            .:
  Fly   254 SL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 65/226 (29%)
Tryp_SPc 25..244 CDD:238113 66/227 (29%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 65/226 (29%)
Tryp_SPc 30..252 CDD:238113 66/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.