Sequence 1: | NP_728833.1 | Gene: | CG32271 / 38392 | FlyBaseID: | FBgn0052271 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650345.1 | Gene: | CG9631 / 41729 | FlyBaseID: | FBgn0027563 | Length: | 439 | Species: | Drosophila melanogaster |
Alignment Length: | 229 | Identity: | 60/229 - (26%) |
---|---|---|---|
Similarity: | 95/229 - (41%) | Gaps: | 33/229 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 VGGVPVDIASVPYLVNLRIG---GNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTET 87
Fly 88 GVRS----GVDKVYTPKAYNTRTL-TSDVAVLKLKAPISGPK-VSTIELCNTSF----KAGDLIK 142
Fly 143 VSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYK-LRGTITNTMFCASVPGVKDACEGDSGGP 206
Fly 207 AVY-----------------QGQLCGIVSWGVGC 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32271 | NP_728833.1 | Tryp_SPc | 24..242 | CDD:214473 | 60/229 (26%) |
Tryp_SPc | 25..244 | CDD:238113 | 60/229 (26%) | ||
CG9631 | NP_650345.1 | GD_N | 26..127 | CDD:292649 | |
Tryp_SPc | 198..436 | CDD:238113 | 60/229 (26%) | ||
Tryp_SPc | 198..433 | CDD:214473 | 60/229 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 74 | 1.000 | Inparanoid score | I3868 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |