DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG9649

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:242 Identity:69/242 - (28%)
Similarity:114/242 - (47%) Gaps:38/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVGGVPVDIASVPYLVNL--RIGG--NFMCGGSLVTPQHVVTAAHCV----KGIGASRILVVAGV 81
            |..|:.|:...:|::..|  .:|.  ||:|||:|::.:.|::||||.    :.:...|.:|..|.
  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGR 321

  Fly    82 TRLT--ETGVRSGVDKVYTPKAYNTRTLT-SDVAVLKLKAPIS-GPKVSTIELCNTSF----KAG 138
            ..|.  .:|...||.::...:.||....| :|:|:|:|...:. |..:..|.|.|.:|    .:|
  Fly   322 NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSG 386

  Fly   139 DLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGT--------ITNTMFCASVPGV 195
            ....|:|||:..:.|:...: .:..|..:|      :|::.||.        ||:...|||....
  Fly   387 HKSYVAGWGEDEKGNRNTRL-AKMTDTDII------TQWECRGNLSEENAKFITSHTICASNAQA 444

  Fly   196 KDACEGDSGGPAVYQGQ----LCGIVSWGVGCARKSS---PGVYTNV 235
            ...|.|||||..:.|.|    |.|:||.|.....:.:   |.:||:|
  Fly   445 SGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 69/242 (29%)
Tryp_SPc 25..244 CDD:238113 69/242 (29%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 69/242 (29%)
Tryp_SPc 259..497 CDD:214473 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.