DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG12951

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:236 Identity:74/236 - (31%)
Similarity:117/236 - (49%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SRIVGGVPVDIASVPYLVNLR-IGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTE 86
            ||:|.|....:...|::|:|| ..|:..||||:::...|:|||||..|..|..:.:..|||.::.
  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISA 92

  Fly    87 TGVR-SGVDKVYTPKAYN-TRTLTSDVAVLKLKAP--ISGPKVSTIELCNTSFKA--------GD 139
            .|.. .|:.|:...:.:: ||...:|:::|.::.|  ..|..|:.:||...:|..        |.
  Fly    93 MGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV 157

  Fly   140 LIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASV-PGVKDACEGDS 203
            ||   ||| :.:...:|...::.|.:.:...:.|.|::..: |......|..| .|.|..|.|||
  Fly   158 LI---GWG-LNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQ-TDPKYHICGGVDEGGKGQCSGDS 217

  Fly   204 GGPAVYQGQLCGIVSWGV-GCARKSSPGVYTNVKTVRSFID 243
            |||.:|.||..|||||.: .|.....||||..|.   .::|
  Fly   218 GGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS---QYVD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 72/232 (31%)
Tryp_SPc 25..244 CDD:238113 72/234 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/235 (31%)
Tryp_SPc 30..260 CDD:238113 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.