DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and prss29

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:248 Identity:83/248 - (33%)
Similarity:122/248 - (49%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLT- 85
            :.|||||...:....|:.::|...|.|:|||||:|...|:|||||...:..|:.....||.:|: 
 Frog    23 SKRIVGGTDSEEGEWPWQISLEFEGGFLCGGSLLTDSWVLTAAHCFDSMNVSKYTAYLGVYQLSD 87

  Fly    86 -ETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPI-SGPKVSTIELC----NTSFKAGDLIKVS 144
             :..|..||..:.....|.....:.|:|:::|:.|| ..|.:..:  |    :.....|.:..|:
 Frog    88 LDNAVLRGVKNITVHPDYMYEGSSGDIALIELEEPIVFTPSIQPV--CLPSQDVPLPMGTMCWVT 150

  Fly   145 GWGQITERNKAVSMQ-VRSVDVALIPRKACMSQYKLR-------GTITNTMFCASV-PGVKDACE 200
            |||.|.|.......| ::..:|.||.|.:|.:.|:..       ..|.:.|.||.. .|..|||:
 Frog   151 GWGNIKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQDDMICAGYKQGKIDACQ 215

  Fly   201 GDSGGPAVYQGQLC---------GIVSWGVGCARKSSPGVYTNVKTVRSFIDK 244
            ||||||.|     |         ||||||:|||..:.|||||||:...::|.:
 Frog   216 GDSGGPLV-----CNTSNTWLQFGIVSWGLGCAEPNQPGVYTNVQYYLTWIQE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 82/242 (34%)
Tryp_SPc 25..244 CDD:238113 82/243 (34%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.