DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG10587

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:240 Identity:91/240 - (37%)
Similarity:139/240 - (57%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SRIVGG-VPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG-IGASRILVVAGVTRLT 85
            :|:||| |..:.....||:.||...||:|||:|:....|:|||||..| :..|..|.|.|.::|.
  Fly    44 TRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKLN 108

  Fly    86 ETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELCNTSFKAGDLIKVSGWGQIT 150
            :.|::..|.:|.....:....:..|||:|:||.|:.|..:..:.||......|..::||||| :|
  Fly   109 DRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMKGKSLGQLILCKKQLMPGTELRVSGWG-LT 172

  Fly   151 ERNK-AVSMQVRSVDVALIPRKACMSQYK-------------LRGTITNTMFCASVPGVKDACEG 201
            |.:: .....:|:|.|.::.:|.|.:.|.             |:..:|::||||.|.|.||||..
  Fly   173 ENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKDACTF 237

  Fly   202 DSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            |||||.||:.|:|||||:|:|||.|...||||::..|:.||::::
  Fly   238 DSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQSI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 89/233 (38%)
Tryp_SPc 25..244 CDD:238113 90/234 (38%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 89/233 (38%)
Tryp_SPc 46..280 CDD:238113 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.