DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG32269

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:227 Identity:92/227 - (40%)
Similarity:130/227 - (57%) Gaps:3/227 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAG 80
            |.|::..||||||....|::.||:|.||.|.| :|.|||:|.|.|:||||||||..||...|..|
  Fly   100 ATSSKIQSRIVGGTSTTISTTPYIVQLRRGSN-LCSGSLITEQWVLTAAHCVKGYSASDFTVRGG 163

  Fly    81 VTRLT-ETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELCNTSFKAGDLIKVS 144
            .|.|. ..||...|..::....:.::.:..|.|:|||...::|..:.||.:.|...|||..::::
  Fly   164 TTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIA 228

  Fly   145 GWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVKDACEGDSGGPAVY 209
            |||...|.:...|..:::..:.::.::.|...|:.:.|||..|.||...| ||:|.||||||...
  Fly   229 GWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAG-KDSCSGDSGGPVTR 292

  Fly   210 QGQLCGIVSWGVGCARKSSPGVYTNVKTVRSF 241
            ...|.||||:|.||||...|||||.|..:|.:
  Fly   293 NNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 89/219 (41%)
Tryp_SPc 25..244 CDD:238113 88/218 (40%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 89/217 (41%)
Tryp_SPc 121..324 CDD:238113 83/204 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.