DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG9897

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:123/277 - (44%) Gaps:61/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGI 70
            ::|.::.|.|.|..:  .||:.|..|:|...|:..::.:.....|||::::..:::|||.||.|.
  Fly     6 ILLQIVALPWLALGD--QRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGY 68

  Fly    71 GASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELCNTSF 135
            .|..|.|..|.:....:|..:|:.||.....|::....:::|:||           |.||.||: 
  Fly    69 SARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLK-----------TCELLNTT- 121

  Fly   136 KAGDLIK----------------VSGWG-----------------QITERNKAVSMQVRSVDVAL 167
               |.||                |:|.|                 .|.|:...:.:|:....|.:
  Fly   122 ---DEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRI 183

  Fly   168 IPRKACMSQYK------LRGTITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARK 226
            :.:|.|.:.:|      |:| |::...|...|| |.||..|.|.|.|...:|.||:| ..||:.|
  Fly   184 LSQKQCAADWKVIPFYLLKG-ISDLTICTKSPG-KGACSTDRGSPLVIDNKLVGILS-RAGCSIK 245

  Fly   227 SSPGVYTNVKTVRSFID 243
              |.||.|:....:::|
  Fly   246 --PDVYANILGHTNWLD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 69/256 (27%)
Tryp_SPc 25..244 CDD:238113 69/258 (27%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.