DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and CG32833

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:231 Identity:62/231 - (26%)
Similarity:106/231 - (45%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTR 83
            |:.|...:||.||:|.:.|::.::.|.....|.|::....|:|||..||.|.....|.|..|.|.
  Fly    32 NDCNRTTLGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTT 96

  Fly    84 LTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPK-VSTIELCNTSFKAGDLIKVSGWG 147
            .::..:...|..:...:.:..:|:..:||:|||..|:...| :..|:|.|.....|..:..:||.
  Fly    97 RSDGVIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWP 161

  Fly   148 QITERNKAV---------SMQVRSVDVALIPRKACMSQYK----LRGTITNTMFCASVPGVKDAC 199
            ..  |..|:         :.:::..:|.|:....|...:.    .:...|:.:||.. ...|:||
  Fly   162 SF--RWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTE-KFAKEAC 223

  Fly   200 EGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNV 235
            ....|.|.|:.|:|.||::.| ||:  ..|.||.|:
  Fly   224 SLAMGSPVVHNGKLVGIITKG-GCS--EYPEVYINL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 60/226 (27%)
Tryp_SPc 25..244 CDD:238113 60/225 (27%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 60/223 (27%)
Tryp_SPc 40..262 CDD:214473 60/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.