DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Prss48

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:253 Identity:85/253 - (33%)
Similarity:120/253 - (47%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVV--AGVTR-LT 85
            |||||....:...|:.|:||......|||||::...|:|||||:|....|.:..|  ..:.| .:
Mouse    39 RIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDREYS 103

  Fly    86 ETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKA---------PISGPKVSTIELCNTSFKAGDLI 141
            .||....|.::..|..:  |...:|:|:|||.:         ||..|.:|.......|      .
Mouse   104 STGKEYYVSRIAIPDKH--RHTEADIALLKLSSRVTFSSVILPICLPNISKQLTVPAS------C 160

  Fly   142 KVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYK--------LRGTITNTMFCASV-PGVKD 197
            .|:||||..|.:...::|  .::|.:|..:||...|.        |...|...||||.. ...||
Mouse   161 WVTGWGQNQEGHYPSTLQ--ELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKD 223

  Fly   198 ACEGDSGGP------AVYQGQLCGIVSWGVGCARKSSPGVYTNV----KTVRSFIDKA 245
            :|:||||||      .|:  :|.|:||||:.|. |..|||||||    |.:.:.|.:|
Mouse   224 SCKGDSGGPLSCHIDGVW--RLMGVVSWGLECG-KDLPGVYTNVTYYQKWISAIISRA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 83/248 (33%)
Tryp_SPc 25..244 CDD:238113 83/249 (33%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 83/244 (34%)
Tryp_SPc 40..274 CDD:238113 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.