DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and thetaTry

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:232 Identity:86/232 - (37%)
Similarity:121/232 - (52%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EANSRIVGGVPVDIASVPYLVNLRI-GGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTR 83
            |...|||||....|.:.||.|:|:. .|:..|||||:....|||||||:.|...|::.|..|.|.
  Fly    30 EREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTL 94

  Fly    84 LTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPK-VSTIELCNTSFKAGDLIKVSGWG 147
            ..|.|:...|.::...:.||::|:..||.:|||...:...: :..|||...:...|....|:|||
  Fly    95 YNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWG 159

  Fly   148 QITERNK------AVSMQVRSVDVALIPRKACMS-QYKLRGTITNTMFCASVPGVKDACEGDSGG 205
                 :|      .:...::.|.|.::..|.|.| :||....|.::|.|| ....||||:|||||
  Fly   160 -----SKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA-YEKKKDACQGDSGG 218

  Fly   206 PAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242
            |......|.||||||..||....||||::|..:|.:|
  Fly   219 PLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 84/226 (37%)
Tryp_SPc 25..244 CDD:238113 84/227 (37%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 84/226 (37%)
Tryp_SPc 35..255 CDD:238113 83/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.