DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and etaTry

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:249 Identity:93/249 - (37%)
Similarity:131/249 - (52%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNF------MCGGSLVTPQHVVTAAH 65
            ||.|:.: :|.|.:::.|||||.........|:|.||...:.      .|||.::....:.||||
  Fly    11 VLFLLGI-YAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAH 74

  Fly    66 CVKGIGASRILVVAG-VTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVST-- 127
            ||....|...||||| .:|....||...|.|:...:.||:.|:.:|:|::.:..|:.....||  
  Fly    75 CVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTME 139

  Fly   128 -IELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS 191
             ||:.:.....|....:|||| .|:.|...|.|::.|.|.::..:.|...|..| .|:..|.||.
  Fly   140 AIEIASEQPAVGVQATISGWG-YTKENGLSSDQLQQVKVPIVDSEKCQEAYYWR-PISEGMLCAG 202

  Fly   192 V-PGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDK 244
            : .|.||||:||||||.|...:|.||||||.||||.:.||||.||...:.:|.|
  Fly   203 LSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 86/228 (38%)
Tryp_SPc 25..244 CDD:238113 86/229 (38%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 86/228 (38%)
Tryp_SPc 28..257 CDD:238113 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455681
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.