DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and kappaTry

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:262 Identity:89/262 - (33%)
Similarity:129/262 - (49%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IPLCWAA---------SNEANSRIVGGVPVDIASVPYLVNLRI----GGNFM--CGGSLVTPQHV 60
            |||...|         |.:...||:.|..||||..||||:||.    ..::|  |.|.:::.|.:
  Fly     3 IPLLLLAIGFSSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQAL 67

  Fly    61 VTAAHCVKGI-GASRILVVAGVTRLTETGVRSGVDKVYTPKA-------YNTRTLTSDVAVLKLK 117
            :|:|.|:.|: ..::::.|||      ...|:|.|....|.|       |:..|:.:|:.||.|.
  Fly    68 ITSAQCLYGLPEETKLVAVAG------ANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLD 126

  Fly   118 APIS----GPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYK 178
            ..:.    |  :|:|.:.......|.|..|:|||...|...: |.::...:|.::..:.|...|.
  Fly   127 TTLDLTLLG--ISSIGIRPERPAVGRLATVAGWGYREEWGPS-SYKLEQTEVPVVSSEQCTQIYG 188

  Fly   179 LRGTITNTMFCAS--VPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSF 241
             .|.:|..|.||.  |.|..|||:||:|||.|..|||.|:||||.||||.:.|.||.   .|.||
  Fly   189 -AGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGRGCARPNYPTVYC---YVASF 249

  Fly   242 ID 243
            :|
  Fly   250 VD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 82/237 (35%)
Tryp_SPc 25..244 CDD:238113 83/239 (35%)
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 84/240 (35%)
Tryp_SPc 26..256 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.