DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and PRSS41

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:285 Identity:82/285 - (28%)
Similarity:119/285 - (41%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCWAAS------------NEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAH 65
            ||.|.|            .|.::.:.|||.......|:..:||:.....|||||::.:.|::|||
Human    47 LCPAESQEEELLSEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAH 111

  Fly    66 CV-KGIGASRILVVAG--VTRLTETGVRSGVDKVYTPKAYNTR--------------TLTSDVAV 113
            |. |....|...|..|  .:|.|...:|          ||::|              .|.:|:|:
Human   112 CFQKHYYPSEWTVQLGELTSRPTPWNLR----------AYSSRYKVQDIIVNPDALGVLRNDIAL 166

  Fly   114 LKLKA---------PISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAV--SMQVRSVDVAL 167
            |:|.:         ||      .||....:|.......|:|||.|:.....:  ...:|...|.:
Human   167 LRLASSVTYNAYIQPI------CIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTI 225

  Fly   168 IPRKAC---MSQYKLRGTITNTMFCASV-PGVKDACEGDSGGPAV-------YQGQLCGIVSWGV 221
            :....|   ..|...|..|.::||||.. .|..|.|:||||||.|       ||   .||||||:
Human   226 LNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQ---VGIVSWGM 287

  Fly   222 GCARKSSPGVYTNVKTVRSFIDKAL 246
            .|.:.:.||||||:.....:|.:.:
Human   288 DCGQPNRPGVYTNISVYFHWIRRVM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 76/256 (30%)
Tryp_SPc 25..244 CDD:238113 77/257 (30%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.