DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and Send2

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:224 Identity:72/224 - (32%)
Similarity:111/224 - (49%) Gaps:21/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTETG 88
            ||:||.|:.|...|:.|:::..|..:||||:.:...::||||||:|.|..   |.||.......|
  Fly    26 RIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQGQGYQ---VRAGSALKNSNG 87

  Fly    89 VRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSGWGQITER 152
            ....|..:.|.:.     |.:|:|:::|..|:. ..:|..|.|..|:...|.:..|||||..:..
  Fly    88 SVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYY 147

  Fly   153 NKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIV 217
            :..:.:|  .|::.:.....|       |....:..||...| :.||:||||||.|:..||.|:|
  Fly   148 SHPIDLQ--GVNLYIQWPYYC-------GLTEPSRICAGSFG-RAACKGDSGGPLVFDQQLVGVV 202

  Fly   218 SWGVGCARKSSPGVYTNVKTVRSFIDKAL 246
            |.|......||  :||:|...|.:|..|:
  Fly   203 SGGTKDCTYSS--IYTSVPYFREWILNAI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 70/218 (32%)
Tryp_SPc 25..244 CDD:238113 70/219 (32%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 70/218 (32%)
Tryp_SPc 27..225 CDD:238113 69/217 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.