DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and PRSS48

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:271 Identity:87/271 - (32%)
Similarity:125/271 - (46%) Gaps:73/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK---------------GIG 71
            :||:|||........|:.|:|....||:||||||:.:.::|||||::               .:|
Human    48 SSRVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGSITVG 112

  Fly    72 ASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKA---------PISGPKVST 127
            .||..|...|:::           |..||..:|   |:|||:|||.:         ||..|.| |
Human   113 DSRKRVKYYVSKI-----------VIHPKYQDT---TADVALLKLSSQVTFTSAILPICLPSV-T 162

  Fly   128 IELCNTSFKAGDLIKVSGWGQITE-RNKAVSMQVRSVDVALIPRKACMSQYK--------LRGTI 183
            .:|....|     ..|:|||::.| .::.....::..:|.:|.|:||...|.        |...|
Human   163 KQLAIPPF-----CWVTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVI 222

  Fly   184 TNTMFCA-SVPGVKDACEGDSGGPAVYQGQLC---------GIVSWGVGCARKSSPGVYTNV--- 235
            .....|| ....:||:|:||||||.     .|         |:||||:.|. ||.|||||||   
Human   223 KEDKICAGDTQNMKDSCKGDSGGPL-----SCHIDGVWIQTGVVSWGLECG-KSLPGVYTNVIYY 281

  Fly   236 -KTVRSFIDKA 245
             |.:.:.|.:|
Human   282 QKWINATISRA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 84/264 (32%)
Tryp_SPc 25..244 CDD:238113 84/265 (32%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 84/260 (32%)
Tryp_SPc 51..288 CDD:238113 83/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.