DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32271 and PRSS53

DIOPT Version :9

Sequence 1:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:279 Identity:73/279 - (26%)
Similarity:107/279 - (38%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRI---LVVAGVTRLTETGVRSGVDKV-- 96
            |:..::|..|..:|.||||....|:|||||.:...|:.:   .||.|  .|...|:..|.::|  
Human    49 PWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLG--SLQREGLSPGAEEVGV 111

  Fly    97 ---YTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELCNTS----FKAGDLIKVSGWGQITERNK 154
               ..|:|||..:..||:|:|:|..|     .:...||...    |..|.....:||.|.|...|
Human   112 AALQLPRAYNHYSQGSDLALLQLAHP-----TTHTPLCLPQPAHRFPFGASCWATGWDQDTSDGK 171

  Fly   155 ---------------------------------------AVSMQ-----VRSVDVALIPRKAC-- 173
                                                   |.|:.     :|::.:.||.|..|  
Human   172 CWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNC 236

  Fly   174 ----MSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAVYQGQLC----------GIVSWGVGC 223
                :.|..|.......|.|.. .|||:..|:||||||.     ||          ||:|:...|
Human   237 IYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPV-----LCLEPDGHWVQAGIISFASSC 296

  Fly   224 ARKSSPGVYTNVKTVRSFI 242
            |::.:|.:.||.....|::
Human   297 AQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 73/277 (26%)
Tryp_SPc 25..244 CDD:238113 73/279 (26%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 73/279 (26%)
Tryp_SPc 43..314 CDD:214473 72/276 (26%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.